PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D07G2413
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 247aa    MW: 28752.2 Da    PI: 6.6258
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D07G2413genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.94.7e-181057148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd+ll+++++++G g W+ ++++ g++R++k+c++rw++yl
      Gh_D07G2413 10 KGAWTEEEDLLLKKCIEKYGEGKWHQVPARAGLNRCRKSCRLRWLNYL 57
                     79********************************************97 PP

2Myb_DNA-binding45.51.7e-1463108148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg + ++E +l+++++++lG++ W++Ia +++ gRt++++k++w+++l
      Gh_D07G2413  63 RGYFAADEVDLIIRLHNLLGNR-WSLIAGRLP-GRTANDVKNYWNTHL 108
                      6778899***************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.367561IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.4E-22759IPR009057Homeodomain-like
SuperFamilySSF466897.65E-297104IPR009057Homeodomain-like
SMARTSM007174.2E-16959IPR001005SANT/Myb domain
PfamPF002494.5E-171057IPR001005SANT/Myb domain
CDDcd001671.18E-111257No hitNo description
Gene3DG3DSA:1.10.10.608.4E-2260111IPR009057Homeodomain-like
PROSITE profilePS5129416.62762112IPR017930Myb domain
SMARTSM007171.9E-1362110IPR001005SANT/Myb domain
PfamPF002493.0E-1363108IPR001005SANT/Myb domain
CDDcd001671.83E-968108No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 247 aa     Download sequence    Send to blast
MEGSSLRVRK GAWTEEEDLL LKKCIEKYGE GKWHQVPARA GLNRCRKSCR LRWLNYLKPN  60
IKRGYFAADE VDLIIRLHNL LGNRWSLIAG RLPGRTANDV KNYWNTHLLK KNIDTSGKNS  120
KPKSYQPNPN TKIIKPRPHI LSKHSFLISL DEYNNNNNNN HAEASNNVAL ANDGNNDYGY  180
CFPNDHDEMM WWENMMINEK EVDGYQLQCS ANDFDQSMLD QPMNEENYGS TIDEVFLDEE  240
LWNVFNP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-22101157110B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.209450.0boll
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC4918770.0KC491877.1 Gossypium arboreum transcription factor AN2 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012447247.11e-175PREDICTED: transcription factor MYB75-like
SwissprotQ9FNV92e-62MY113_ARATH; Transcription factor MYB113
TrEMBLA0A0D2PP181e-175A0A0D2PP18_G
STRINGVIT_02s0033g00410.t012e-70(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66370.17e-63myb domain protein 113